PDB entry 2iss

View 2iss on RCSB PDB site
Description: Structure of the PLP synthase Holoenzyme from Thermotoga maritima
Class: lyase, transferase
Keywords: (beta/alpha)8-barrel, alpha/beta three layer sandwich, LYASE, TRANSFERASE
Deposited on 2006-10-18, released 2007-01-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.213
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxal biosynthesis lyase pdxS
    Species: Thermotoga maritima [TaxId:2336]
    Gene: pdxS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYU4 (20-End)
      • expression tag (19)
    Domains in SCOPe 2.06: d2issa1, d2issa2
  • Chain 'B':
    Compound: Pyridoxal biosynthesis lyase pdxS
    Species: Thermotoga maritima [TaxId:2336]
    Gene: pdxS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYU4 (20-End)
      • expression tag (15-19)
    Domains in SCOPe 2.06: d2issb1, d2issb2
  • Chain 'C':
    Compound: Pyridoxal biosynthesis lyase pdxS
    Species: Thermotoga maritima [TaxId:2336]
    Gene: pdxS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2issc_
  • Chain 'D':
    Compound: Glutamine amidotransferase subunit pdxT
    Species: Thermotoga maritima [TaxId:2336]
    Gene: pdxT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYU3 (20-End)
      • expression tag (19)
    Domains in SCOPe 2.06: d2issd1, d2issd2
  • Chain 'E':
    Compound: Glutamine amidotransferase subunit pdxT
    Species: Thermotoga maritima [TaxId:2336]
    Gene: pdxT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2isse_
  • Chain 'F':
    Compound: Glutamine amidotransferase subunit pdxT
    Species: Thermotoga maritima [TaxId:2336]
    Gene: pdxT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2issf_
  • Heterogens: 5RP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2issA (A:)
    mgsshhhhhhssglvprgshmeikkgtwiikkgfaemfkggvimdvtsaeqakiaeeaga
    vavmalervpadirkeggvarmasiakireimeavsipvmakvrighiaeakileelgvd
    fidesevltpaddrfhinkhefkvpfvcgardlgealrriaegaamirtkgeagtgnvve
    avkhmrrvmeqikqvtkmedeelvaygkeigapvellrevkrlgrlpvvnfaaggvatpa
    daalmmmlgadgvfvgsgifkskdprkmakamvlavtywdnprillkisedigepmrgld
    veelevrmqergw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2issA (A:)
    hmeikkgtwiikkgfaemfkggvimdvtsaeqakiaeeagavavmalervpadirkeggv
    armasiakireimeavsipvmakvrighiaeakileelgvdfidesevltpaddrfhink
    hefkvpfvcgardlgealrriaegaamirtkgeagtgnvveavkhmrrvmeqikqvtkme
    deelvaygkeigapvellrevkrlgrlpvvnfaaggvatpadaalmmmlgadgvfvgsgi
    fkskdprkmakamvlavtywdnprillkisedigepmrgld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2issB (B:)
    mgsshhhhhhssglvprgshmeikkgtwiikkgfaemfkggvimdvtsaeqakiaeeaga
    vavmalervpadirkeggvarmasiakireimeavsipvmakvrighiaeakileelgvd
    fidesevltpaddrfhinkhefkvpfvcgardlgealrriaegaamirtkgeagtgnvve
    avkhmrrvmeqikqvtkmedeelvaygkeigapvellrevkrlgrlpvvnfaaggvatpa
    daalmmmlgadgvfvgsgifkskdprkmakamvlavtywdnprillkisedigepmrgld
    veelevrmqergw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2issB (B:)
    prgshmeikkgtwiikkgfaemfkggvimdvtsaeqakiaeeagavavmalervpadirk
    eggvarmasiakireimeavsipvmakvrighiaeakileelgvdfidesevltpaddrf
    hinkhefkvpfvcgardlgealrriaegaamirtkgeagtgnvveavkhmrrvmeqikqv
    tkmedeelvaygkeigapvellrevkrlgrlpvvnfaaggvatpadaalmmmlgadgvfv
    gsgifkskdprkmakamvlavtywdnprillkisedigepmrgld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2issC (C:)
    mgsshhhhhhssglvprgshmeikkgtwiikkgfaemfkggvimdvtsaeqakiaeeaga
    vavmalervpadirkeggvarmasiakireimeavsipvmakvrighiaeakileelgvd
    fidesevltpaddrfhinkhefkvpfvcgardlgealrriaegaamirtkgeagtgnvve
    avkhmrrvmeqikqvtkmedeelvaygkeigapvellrevkrlgrlpvvnfaaggvatpa
    daalmmmlgadgvfvgsgifkskdprkmakamvlavtywdnprillkisedigepmrgld
    veelevrmqergw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2issC (C:)
    meikkgtwiikkgfaemfkggvimdvtsaeqakiaeeagavavmalervpadirkeggva
    rmasiakireimeavsipvmakvrighiaeakileelgvdfidesevltpaddrfhinkh
    efkvpfvcgardlgealrriaegaamirtkgeagtgnvveavkhmrrvmeqikqvtkmed
    eelvaygkeigapvellrevkrlgrlpvvnfaaggvatpadaalmmmlgadgvfvgsgif
    kskdprkmakamvlavtywdnprillkisedigepmrgld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2issD (D:)
    mgsshhhhhhssglvprgshmkigvlgvqgdvrehvealhklgvetlivklpeqldmvdg
    lilpggesttmirilkemdmdeklverinnglpvfatcagvillakriknysqeklgvld
    itvernaygrqvesfetfveipavgkdpfraifiraprivetgknveilatydydpvlvk
    egnilactfhpeltddlrlhryflemvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2issD (D:)
    hmkigvlgvqgdvrehvealhklgvetlivklpeqldmvdglilpggesttmirilkemd
    mdeklverinnglpvfatcagvillakrikqeklgvlditvernaygrqvesfetfveip
    avgkdpfraifiraprivetgknveilatydydpvlvkegnilactfhpeltddlrlhry
    flemv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2issE (E:)
    mgsshhhhhhssglvprgshmkigvlgvqgdvrehvealhklgvetlivklpeqldmvdg
    lilpggesttmirilkemdmdeklverinnglpvfatcagvillakriknysqeklgvld
    itvernaygrqvesfetfveipavgkdpfraifiraprivetgknveilatydydpvlvk
    egnilactfhpeltddlrlhryflemvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2issE (E:)
    mkigvlgvqgdvrehvealhklgvetlivklpeqldmvdglilpggesttmirilkemdm
    deklverinnglpvfatcagvillakrikqeklgvlditvernaygrqvesfetfveipa
    vgkdpfraifiraprivetgknveilatydydpvlvkegnilactfhpeltddlrlhryf
    lemv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2issF (F:)
    mgsshhhhhhssglvprgshmkigvlgvqgdvrehvealhklgvetlivklpeqldmvdg
    lilpggesttmirilkemdmdeklverinnglpvfatcagvillakriknysqeklgvld
    itvernaygrqvesfetfveipavgkdpfraifiraprivetgknveilatydydpvlvk
    egnilactfhpeltddlrlhryflemvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2issF (F:)
    mkigvlgvqgdvrehvealhklgvetlivklpeqldmvdglilpggesttmirilkemdm
    deklverinnglpvfatcagvillakrikqeklgvlditvernaygrqvesfetfveipa
    vgkdpfraifiraprivetgknveilatydydpvlvkegnilactfhpeltddlrlhryf
    lemv