PDB entry 2isb

View 2isb on RCSB PDB site
Description: Crystal structure of Fumarase of FUM-1 (NP_069927.1) from Archaeoglobus Fulgidus at 1.66 A resolution
Class: Lyase
Keywords: NP_069927.1, Fumarase of FUM-1, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, Lyase
Deposited on 2006-10-17, released 2006-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.175
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: FUM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29167 (12-191)
      • leader sequence (8-11)
      • modified residue (12)
      • modified residue (14)
      • modified residue (57)
      • modified residue (98)
      • modified residue (112)
      • modified residue (120)
      • modified residue (128)
      • modified residue (147)
      • modified residue (162)
    Domains in SCOPe 2.06: d2isba2, d2isba3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2isbA (A:)
    mgsdkihhhhhhmvmeyelrtplvkdqilklkvgdvvyitgeiftardeaharalewmee
    gkelpfsfdkgvvyhcgplvkkndewrvvsagpttsarmnpftpkilekvecmgiigkgg
    mseevveamrgkaayfaftggagalaamsikkvkgvvwedlgmpeavwlleverfgpciv
    aidahgnslyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2isbA (A:)
    hhhhmvmeyelrtplvkdqilklkvgdvvyitgeiftardeaharalewmeegkelpfsf
    dkgvvyhcgplvkkndewrvvsagpttsarmnpftpkilekvecmgiigkggmseevvea
    mrgkaayfaftggagalaamsikkvkgvvwedlgmpeavwlleverfgpcivaidahgns
    lyrr