PDB entry 2isa

View 2isa on RCSB PDB site
Description: Crystal Structure of Vibrio salmonicida catalase
Class: Oxidoreductase
Keywords: Peroxidase, Heme, Oxidoreductase, Iron, Hydrogen peroxide
Deposited on 2006-10-17, released 2007-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.151
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase
    Species: Vibrio salmonicida [TaxId:316275]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3LSM1 (Start-482)
      • modified residue (51)
    Domains in SCOPe 2.06: d2isaa_
  • Chain 'B':
    Compound: catalase
    Species: Vibrio salmonicida [TaxId:316275]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3LSM1 (Start-482)
      • modified residue (51)
    Domains in SCOPe 2.06: d2isab_
  • Chain 'C':
    Compound: catalase
    Species: Vibrio salmonicida [TaxId:316275]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3LSM1 (Start-482)
      • modified residue (51)
    Domains in SCOPe 2.06: d2isac_
  • Chain 'D':
    Compound: catalase
    Species: Vibrio salmonicida [TaxId:316275]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3LSM1 (Start-482)
      • modified residue (51)
    Domains in SCOPe 2.06: d2isad_
  • Chain 'E':
    Compound: catalase
    Species: Vibrio salmonicida [TaxId:316275]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3LSM1 (Start-482)
      • modified residue (51)
    Domains in SCOPe 2.06: d2isae_
  • Chain 'F':
    Compound: catalase
    Species: Vibrio salmonicida [TaxId:316275]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3LSM1 (Start-482)
      • modified residue (51)
    Domains in SCOPe 2.06: d2isaf_
  • Chain 'G':
    Compound: catalase
    Species: Vibrio salmonicida [TaxId:316275]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3LSM1 (Start-482)
      • modified residue (51)
    Domains in SCOPe 2.06: d2isag_
  • Chain 'H':
    Compound: catalase
    Species: Vibrio salmonicida [TaxId:316275]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3LSM1 (Start-482)
      • modified residue (51)
    Domains in SCOPe 2.06: d2isah_
  • Heterogens: CL, HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2isaA (A:)
    mskklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgay
    gtftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegn
    wdlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsd
    rgipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshq
    rdlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnp
    qnyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpv
    hsyhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsq
    pgdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdise
    yns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2isaA (A:)
    skklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgayg
    tftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegnw
    dlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsdr
    gipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshqr
    dlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnpq
    nyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpvh
    syhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsqp
    gdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdisey
    ns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2isaB (B:)
    mskklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgay
    gtftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegn
    wdlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsd
    rgipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshq
    rdlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnp
    qnyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpv
    hsyhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsq
    pgdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdise
    yns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2isaB (B:)
    skklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgayg
    tftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegnw
    dlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsdr
    gipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshqr
    dlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnpq
    nyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpvh
    syhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsqp
    gdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdisey
    ns
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2isaC (C:)
    mskklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgay
    gtftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegn
    wdlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsd
    rgipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshq
    rdlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnp
    qnyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpv
    hsyhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsq
    pgdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdise
    yns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2isaC (C:)
    skklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgayg
    tftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegnw
    dlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsdr
    gipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshqr
    dlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnpq
    nyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpvh
    syhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsqp
    gdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdisey
    ns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2isaD (D:)
    mskklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgay
    gtftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegn
    wdlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsd
    rgipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshq
    rdlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnp
    qnyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpv
    hsyhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsq
    pgdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdise
    yns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2isaD (D:)
    skklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgayg
    tftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegnw
    dlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsdr
    gipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshqr
    dlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnpq
    nyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpvh
    syhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsqp
    gdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdisey
    ns
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2isaE (E:)
    mskklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgay
    gtftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegn
    wdlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsd
    rgipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshq
    rdlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnp
    qnyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpv
    hsyhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsq
    pgdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdise
    yns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2isaE (E:)
    skklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgayg
    tftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegnw
    dlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsdr
    gipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshqr
    dlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnpq
    nyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpvh
    syhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsqp
    gdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdisey
    ns
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2isaF (F:)
    mskklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgay
    gtftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegn
    wdlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsd
    rgipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshq
    rdlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnp
    qnyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpv
    hsyhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsq
    pgdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdise
    yns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2isaF (F:)
    skklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgayg
    tftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegnw
    dlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsdr
    gipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshqr
    dlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnpq
    nyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpvh
    syhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsqp
    gdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdisey
    ns
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2isaG (G:)
    mskklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgay
    gtftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegn
    wdlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsd
    rgipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshq
    rdlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnp
    qnyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpv
    hsyhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsq
    pgdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdise
    yns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2isaG (G:)
    skklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgayg
    tftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegnw
    dlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsdr
    gipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshqr
    dlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnpq
    nyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpvh
    syhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsqp
    gdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdisey
    ns
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2isaH (H:)
    mskklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgay
    gtftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegn
    wdlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsd
    rgipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshq
    rdlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnp
    qnyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpv
    hsyhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsq
    pgdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdise
    yns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2isaH (H:)
    skklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgayg
    tftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegnw
    dlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsdr
    gipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshqr
    dlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnpq
    nyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpvh
    syhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsqp
    gdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdisey
    ns