PDB entry 2irw

View 2irw on RCSB PDB site
Description: Human 11-beta-Hydroxysteroid Dehydrogenase (HSD1) with NADP and Adamantane Ether Inhibitor
Class: oxidoreductase
Keywords: HSD1, NADP, inhibitor, OXIDOREDUCTASE
Deposited on 2006-10-16, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (0-263)
      • conflict (246)
    Domains in SCOPe 2.07: d2irwa_
  • Chain 'B':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (0-263)
      • conflict (246)
    Domains in SCOPe 2.07: d2irwb_
  • Chain 'C':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (0-End)
      • conflict (246)
    Domains in SCOPe 2.07: d2irwc_
  • Chain 'D':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (0-263)
      • conflict (246)
    Domains in SCOPe 2.07: d2irwd_
  • Chain 'E':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (0-End)
      • conflict (246)
    Domains in SCOPe 2.07: d2irwe_
  • Chain 'F':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (0-263)
      • conflict (246)
    Domains in SCOPe 2.07: d2irwf_
  • Chain 'G':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (0-263)
      • conflict (246)
    Domains in SCOPe 2.07: d2irwg_
  • Chain 'H':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (0-263)
      • conflict (246)
    Domains in SCOPe 2.07: d2irwh_
  • Heterogens: NAP, NN4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2irwA (A:)
    efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
    ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
    syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
    vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
    llirnpsrkileflystsynmdrf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2irwB (B:)
    efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
    ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
    syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
    vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
    llirnpsrkileflystsynmdrf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2irwC (C:)
    efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
    ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
    syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
    vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
    llirnpsrkileflystsynmdrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2irwC (C:)
    efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
    ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
    syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
    vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
    llirnpsrkileflyst
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2irwD (D:)
    efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
    ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
    syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
    vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
    llirnpsrkileflystsynmdrf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2irwE (E:)
    efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
    ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
    syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
    vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
    llirnpsrkileflystsynmdrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2irwE (E:)
    efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
    ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
    syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
    vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
    llirnpsrkileflyst
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2irwF (F:)
    efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
    ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
    syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
    vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
    llirnpsrkileflystsynmdrf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2irwG (G:)
    efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
    ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
    syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
    vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
    llirnpsrkileflystsynmdrf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2irwH (H:)
    efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
    ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
    syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
    vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
    llirnpsrkileflystsynmdrf