PDB entry 2irv

View 2irv on RCSB PDB site
Description: Crystal structure of GlpG, a rhomboid intramembrane serine protease
Class: membrane protein
Keywords: membrane protein, cavity, ser-his dyad
Deposited on 2006-10-16, released 2006-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein glpG
    Species: Escherichia coli [TaxId:83333]
    Gene: glpG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2irva_
  • Chain 'B':
    Compound: Protein glpG
    Species: Escherichia coli [TaxId:83333]
    Gene: glpG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2irvb_
  • Heterogens: PO4, LDA, LMT, PGV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2irvA (A:)
    ragpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmhi
    lfnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgyv
    wlrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdsln
    ar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2irvA (A:)
    ragpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmhi
    lfnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgyv
    wlrgerdpqsgiylqrgliifaliwivagwfdangahiaglavglamafvdslnar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2irvB (B:)
    ragpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmhi
    lfnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgyv
    wlrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdsln
    ar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2irvB (B:)
    agpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmhil
    fnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgyvw
    lrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdsln