PDB entry 2irf

View 2irf on RCSB PDB site
Description: crystal structure of an irf-2/DNA complex.
Class: gene regulation/DNA
Keywords: transcription factor, ifn induction, irf family, gene regulation/DNA complex
Deposited on 1999-05-30, released 1999-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(p*ap*ap*gp*tp*gp*ap*ap*ap*gp*(5iu)p*gp*a)-3')
  • Chain 'B':
    Compound: DNA (5'-d(p*ap*ap*gp*tp*gp*ap*ap*ap*gp*(5iu)p*gp*a)-3')
  • Chain 'C':
    Compound: DNA (5'-d(p*ap*ap*gp*tp*gp*ap*ap*ap*gp*(5iu)p*gp*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*tp*cp*ap*cp*tp*tp*tp*cp*ap*cp*(5iu)p*t)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*tp*tp*cp*ap*cp*tp*tp*tp*cp*ap*cp*(5iu)p*t)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*tp*tp*cp*ap*cp*tp*tp*tp*cp*ap*cp*(5iu)p*t)-3')
  • Chain 'G':
    Compound: interferon regulatory factor 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2irfg_
  • Chain 'H':
    Compound: interferon regulatory factor 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2irfh_
  • Chain 'I':
    Compound: interferon regulatory factor 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2irfi_
  • Chain 'J':
    Compound: interferon regulatory factor 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2irfj_
  • Chain 'K':
    Compound: interferon regulatory factor 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2irfk_
  • Chain 'L':
    Compound: interferon regulatory factor 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2irfl_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2irfG (G:)
    mpvermrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwai
    htgkhqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2irfG (G:)
    rmrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwaihtgk
    hqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2irfH (H:)
    mpvermrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwai
    htgkhqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2irfH (H:)
    rmrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwaihtgk
    hqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2irfI (I:)
    mpvermrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwai
    htgkhqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2irfI (I:)
    rmrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwaihtgk
    hqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2irfJ (J:)
    mpvermrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwai
    htgkhqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2irfJ (J:)
    rmrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwaihtgk
    hqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2irfK (K:)
    mpvermrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwai
    htgkhqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2irfK (K:)
    rmrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwaihtgk
    hqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2irfL (L:)
    mpvermrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwai
    htgkhqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2irfL (L:)
    rmrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwaihtgk
    hqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp