PDB entry 2iqq

View 2iqq on RCSB PDB site
Description: The Crystal Structure of Iron, Sulfur-Dependent L-serine dehydratase from Legionella pneumophila subsp. pneumophila
Class: lyase
Keywords: alpha-beta, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, LYASE
Deposited on 2006-10-14, released 2006-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron, Sulfur-Dependent L-serine dehydratase
    Species: Legionella pneumophila [TaxId:272624]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2iqqa1
  • Chain 'B':
    Compound: Iron, Sulfur-Dependent L-serine dehydratase
    Species: Legionella pneumophila [TaxId:272624]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2iqqb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iqqA (A:)
    snasvfdlfsigigpssshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkg
    hgtdkailnglenkapetvdpasmiprmheildsnllnlagkkeipfheatdflflqkel
    lpkhsngmrfsafdgnanllieqvyysigggfitteedfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iqqA (A:)
    sshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkghgtdkailnglenkap
    etvdpasmiprmheildsnllnlagkkeipfheatdflflqkellpkhsngmrfsafdgn
    anllieqvyysigggfitteedfdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iqqB (B:)
    snasvfdlfsigigpssshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkg
    hgtdkailnglenkapetvdpasmiprmheildsnllnlagkkeipfheatdflflqkel
    lpkhsngmrfsafdgnanllieqvyysigggfitteedfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iqqB (B:)
    sshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkghgtdkailnglenkap
    etvdpasmiprmheildsnllnlagkkeipfheatdflflqkellpkhsngmrfsafdgn
    anllieqvyysigggfitteedfdk