PDB entry 2iqh

View 2iqh on RCSB PDB site
Description: Influenza A virus nucleoprotein NP at 3.2A resolution
Class: viral protein
Keywords: oligomerization, RNA binding, NLS, polymerase binding
Deposited on 2006-10-13, released 2006-12-26
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.273
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleocapsid protein
    Species: Influenza A virus
    Gene: NP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2iqha1
  • Chain 'B':
    Compound: nucleocapsid protein
    Species: Influenza A virus
    Gene: NP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2iqhb1
  • Chain 'C':
    Compound: nucleocapsid protein
    Species: Influenza A virus
    Gene: NP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2iqhc1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iqhA (A:)
    rsyeqmetdgerqnateirasvgkmidgigrfyiqmctelklsdyegrliqnsltiermv
    lsafderrnkyleehpsagkdpkktggpiyrrvdgkwrrelilydkeeirriwrqanngd
    dataglthmmiwhsnlndatyqrtralvrtgmdprmcslmqgstlprrsgaagaavkgvg
    tmvmelirmikrgindrnfwrgengrrtriayermcnilkgkfqtaaqrtmvdqvresrn
    pgnaefedliflarsalilrgsvahksclpacvygsavasgydferegyslvgidpfrll
    qnsqvyslirpnenpahksqlvwmachsaafedlrvssfirgtkvvprgklstrgvqias
    nenmetmesstlelrsrywairtrsggntnqqrassgqisiqptfsvqrnlpfdrptima
    aftgntegrtsdmrteiirlmesarpedvsfqgrgvfelsdekatspivpsfdmsnegsy
    ffgdnaeeydnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iqhA (A:)
    nateirasvgkmidgigrfyiqmctelklsdyegrliqnsltiermvlsafdtggpiyrr
    vdgkwrrelilydkeeirriwrqanngddataglthmmiwhsnlndatyqrtralvrtgm
    dprmcslmqgstlprrsgaagaavkgvgtmvmelirmikrginrrtriayermcnilkgk
    fqtaaqrtmvdqvresrnpgnaefedliflarsalilrgsvahksclpacvygsavasgy
    dferegyslvgidpfrllqnsqvyslirpnenpahksqlvwmachsaafedlrvssfirg
    tkvvprgklstrgvqiasnenmetmesstlelrsrywairtrsggntssgqisiqptfsv
    qrnlpfdrptimaasdmrteiirlmesarpedvsfqgrgvfelsdekatspivpsfdmsn
    egsyff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iqhB (B:)
    rsyeqmetdgerqnateirasvgkmidgigrfyiqmctelklsdyegrliqnsltiermv
    lsafderrnkyleehpsagkdpkktggpiyrrvdgkwrrelilydkeeirriwrqanngd
    dataglthmmiwhsnlndatyqrtralvrtgmdprmcslmqgstlprrsgaagaavkgvg
    tmvmelirmikrgindrnfwrgengrrtriayermcnilkgkfqtaaqrtmvdqvresrn
    pgnaefedliflarsalilrgsvahksclpacvygsavasgydferegyslvgidpfrll
    qnsqvyslirpnenpahksqlvwmachsaafedlrvssfirgtkvvprgklstrgvqias
    nenmetmesstlelrsrywairtrsggntnqqrassgqisiqptfsvqrnlpfdrptima
    aftgntegrtsdmrteiirlmesarpedvsfqgrgvfelsdekatspivpsfdmsnegsy
    ffgdnaeeydnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iqhB (B:)
    nateirasvgkmidgigrfyiqmctelklsdyegrliqnsltiermvlsafdtggpiyrr
    vdgkwrrelilydkeeirriwrqanngddataglthmmiwhsnlndatyqrtralvrtgm
    dprmcslmqgstlprrsgaagaavkgvgtmvmelirmikrginrrtriayermcnilkgk
    fqtaaqrtmvdqvresrnpgnaefedliflarsalilrgsvahksclpacvygsavasgy
    dferegyslvgidpfrllqnsqvyslirpnenpahksqlvwmachsaafedlrvssfirg
    tkvvprgklstrgvqiasnenmetmesstlelrsrywairtrsggntssgqisiqptfsv
    qrnlpfdrptimaasdmrteiirlmesarpedvsfqgrgvfelsdekatspivpsfdmsn
    egsyff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2iqhC (C:)
    rsyeqmetdgerqnateirasvgkmidgigrfyiqmctelklsdyegrliqnsltiermv
    lsafderrnkyleehpsagkdpkktggpiyrrvdgkwrrelilydkeeirriwrqanngd
    dataglthmmiwhsnlndatyqrtralvrtgmdprmcslmqgstlprrsgaagaavkgvg
    tmvmelirmikrgindrnfwrgengrrtriayermcnilkgkfqtaaqrtmvdqvresrn
    pgnaefedliflarsalilrgsvahksclpacvygsavasgydferegyslvgidpfrll
    qnsqvyslirpnenpahksqlvwmachsaafedlrvssfirgtkvvprgklstrgvqias
    nenmetmesstlelrsrywairtrsggntnqqrassgqisiqptfsvqrnlpfdrptima
    aftgntegrtsdmrteiirlmesarpedvsfqgrgvfelsdekatspivpsfdmsnegsy
    ffgdnaeeydnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iqhC (C:)
    nateirasvgkmidgigrfyiqmctelklsdyegrliqnsltiermvlsafdtggpiyrr
    vdgkwrrelilydkeeirriwrqanngddataglthmmiwhsnlndatyqrtralvrtgm
    dprmcslmqgstlprrsgaagaavkgvgtmvmelirmikrgindrnfwrgengrrtriay
    ermcnilkgkfqtaaqrtmvdqvresrnpgnaefedliflarsalilrgsvahksclpac
    vygsavasgydferegyslvgidpfrllqnsqvyslirpnenpahksqlvwmachsaafe
    dlrvssfirgtkvvprgklstrgvqiasnenmetmesstlelrsrywairtrsggntssg
    qisiqptfsvqrnlpfdrptimaasdmrteiirlmesarpedvsfqgrgvfelsdekats
    pivpsfdmsnegsyff