PDB entry 2iqf

View 2iqf on RCSB PDB site
Description: Crystal structure of Helicobacter pylori catalase compound I
Class: oxidoreductase
Keywords: hydroxoferryl heme, beta barrel, OXIDOREDUCTASE
Deposited on 2006-10-13, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.151
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase
    Species: Helicobacter pylori [TaxId:210]
    Gene: katA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77872 (0-End)
      • modified residue (161)
      • modified residue (180)
      • conflict (233)
      • conflict (236)
      • conflict (247)
      • conflict (254)
      • conflict (285)
      • modified residue (291)
      • conflict (315)
      • modified residue (371)
    Domains in SCOPe 2.07: d2iqfa_
  • Chain 'B':
    Compound: catalase
    Species: Helicobacter pylori [TaxId:210]
    Gene: katA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77872 (0-End)
      • modified residue (161)
      • modified residue (180)
      • conflict (233)
      • conflict (236)
      • conflict (247)
      • conflict (254)
      • conflict (285)
      • modified residue (291)
      • conflict (315)
      • modified residue (371)
    Domains in SCOPe 2.07: d2iqfb_
  • Heterogens: ACT, HEM, O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iqfA (A:)
    mvnkdvkqttafgapvwddnnvitagprgpvllqstwfleklaafdreripervvhakgs
    gaygtftvtkditkytkakifskvgkktecffrfstvagergsadavrdprgfamkyyte
    egnwdlvgnntpvffirdaikfpdfihtqkrdpqtnlpnhdmvwdfwsnvpeslyqvtwv
    msdrgipksfrhmdgfgshtfslinakgerfwvkfhfhtmqgvkhltneeaaeirkhdpd
    snqrdlfdaiargdypkwklsiqvmpeedakkyrfhpfdvtkiwytqdyplmevgiveln
    knpenyfaeveqaaftpanvvpgigyspdrmlqgrlfsygdthryrlgvnypqipvnkpr
    cpfhsssrdgymqngyygslqnytpsslpgykedksardpkfnlahiekefevwnwdyra
    ddsdyytqpgdyyrslpadekerlhdtigeslahvthkeivdkqlehfkkadpkyaegvk
    kalekhqkmmkdmhgkdmhhtkkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iqfA (A:)
    mvnkdvkqttafgapvwddnnvitagprgpvllqstwfleklaafdreripervvhakgs
    gaygtftvtkditkytkakifskvgkktecffrfstvagergsadavrdprgfamkyyte
    egnwdlvgnntpvffirdaikfpdfihtqkrdpqtnlpnhdmvwdfwsnvpeslyqvtwv
    msdrgipksfrhmdgfgshtfslinakgerfwvkfhfhtmqgvkhltneeaaeirkhdpd
    snqrdlfdaiargdypkwklsiqvmpeedakkyrfhpfdvtkiwytqdyplmevgiveln
    knpenyfaeveqaaftpanvvpgigyspdrmlqgrlfsygdthryrlgvnypqipvnkpr
    cpfhsssrdgymqngyygslqnytpsslpgykedksardpkfnlahiekefevwnwdyra
    ddsdyytqpgdyyrslpadekerlhdtigeslahvthkeivdkqlehfkkadpkyaegvk
    kalekhqkmmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iqfB (B:)
    mvnkdvkqttafgapvwddnnvitagprgpvllqstwfleklaafdreripervvhakgs
    gaygtftvtkditkytkakifskvgkktecffrfstvagergsadavrdprgfamkyyte
    egnwdlvgnntpvffirdaikfpdfihtqkrdpqtnlpnhdmvwdfwsnvpeslyqvtwv
    msdrgipksfrhmdgfgshtfslinakgerfwvkfhfhtmqgvkhltneeaaeirkhdpd
    snqrdlfdaiargdypkwklsiqvmpeedakkyrfhpfdvtkiwytqdyplmevgiveln
    knpenyfaeveqaaftpanvvpgigyspdrmlqgrlfsygdthryrlgvnypqipvnkpr
    cpfhsssrdgymqngyygslqnytpsslpgykedksardpkfnlahiekefevwnwdyra
    ddsdyytqpgdyyrslpadekerlhdtigeslahvthkeivdkqlehfkkadpkyaegvk
    kalekhqkmmkdmhgkdmhhtkkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iqfB (B:)
    mvnkdvkqttafgapvwddnnvitagprgpvllqstwfleklaafdreripervvhakgs
    gaygtftvtkditkytkakifskvgkktecffrfstvagergsadavrdprgfamkyyte
    egnwdlvgnntpvffirdaikfpdfihtqkrdpqtnlpnhdmvwdfwsnvpeslyqvtwv
    msdrgipksfrhmdgfgshtfslinakgerfwvkfhfhtmqgvkhltneeaaeirkhdpd
    snqrdlfdaiargdypkwklsiqvmpeedakkyrfhpfdvtkiwytqdyplmevgiveln
    knpenyfaeveqaaftpanvvpgigyspdrmlqgrlfsygdthryrlgvnypqipvnkpr
    cpfhsssrdgymqngyygslqnytpsslpgykedksardpkfnlahiekefevwnwdyra
    ddsdyytqpgdyyrslpadekerlhdtigeslahvthkeivdkqlehfkkadpkyaegvk
    kalekhqkmmk