PDB entry 2iq7

View 2iq7 on RCSB PDB site
Description: Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins
Class: hydrolase
Keywords: parallel beta helix, HYDROLASE
Deposited on 2006-10-13, released 2007-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.154
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endopolygalacturonase
    Species: Colletotrichum lupini [TaxId:145971]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iq7a_
  • Chain 'B':
    Compound: endopolygalacturonase
    Species: Colletotrichum lupini [TaxId:145971]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iq7b_
  • Chain 'C':
    Compound: endopolygalacturonase
    Species: Colletotrichum lupini [TaxId:145971]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iq7c_
  • Chain 'D':
    Compound: endopolygalacturonase
    Species: Colletotrichum lupini [TaxId:145971]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iq7d_
  • Chain 'E':
    Compound: endopolygalacturonase
    Species: Colletotrichum lupini [TaxId:145971]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iq7e_
  • Chain 'F':
    Compound: endopolygalacturonase
    Species: Colletotrichum lupini [TaxId:145971]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iq7f_
  • Chain 'G':
    Compound: endopolygalacturonase
    Species: Colletotrichum lupini [TaxId:145971]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iq7g_
  • Heterogens: PG4, PEG, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iq7A (A:)
    asctftdaaaaikgkasctsiilngivvpagttldmtglksgttvtfqgkttfgykeweg
    plisfsgtniningasghsidcqgsrwwdskgsnggktkpkffyahslkssnikglnvln
    tpvqafsinsattlgvydviidnsagdsagghntdafdvgsstgvyisganvknqddcla
    insgtnitftggtcsgghglsigsvggrsdntvktvtisnskivnsdngvriktvsgatg
    svsgvtysgitlsniakygivieqdyengsptgtptngvpitgltlskitgsvassgtnv
    yilcasgacsnwkwsgvsvtggkkstkcsnipsgsgaac
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iq7B (B:)
    asctftdaaaaikgkasctsiilngivvpagttldmtglksgttvtfqgkttfgykeweg
    plisfsgtniningasghsidcqgsrwwdskgsnggktkpkffyahslkssnikglnvln
    tpvqafsinsattlgvydviidnsagdsagghntdafdvgsstgvyisganvknqddcla
    insgtnitftggtcsgghglsigsvggrsdntvktvtisnskivnsdngvriktvsgatg
    svsgvtysgitlsniakygivieqdyengsptgtptngvpitgltlskitgsvassgtnv
    yilcasgacsnwkwsgvsvtggkkstkcsnipsgsgaac
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iq7C (C:)
    asctftdaaaaikgkasctsiilngivvpagttldmtglksgttvtfqgkttfgykeweg
    plisfsgtniningasghsidcqgsrwwdskgsnggktkpkffyahslkssnikglnvln
    tpvqafsinsattlgvydviidnsagdsagghntdafdvgsstgvyisganvknqddcla
    insgtnitftggtcsgghglsigsvggrsdntvktvtisnskivnsdngvriktvsgatg
    svsgvtysgitlsniakygivieqdyengsptgtptngvpitgltlskitgsvassgtnv
    yilcasgacsnwkwsgvsvtggkkstkcsnipsgsgaac
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iq7D (D:)
    asctftdaaaaikgkasctsiilngivvpagttldmtglksgttvtfqgkttfgykeweg
    plisfsgtniningasghsidcqgsrwwdskgsnggktkpkffyahslkssnikglnvln
    tpvqafsinsattlgvydviidnsagdsagghntdafdvgsstgvyisganvknqddcla
    insgtnitftggtcsgghglsigsvggrsdntvktvtisnskivnsdngvriktvsgatg
    svsgvtysgitlsniakygivieqdyengsptgtptngvpitgltlskitgsvassgtnv
    yilcasgacsnwkwsgvsvtggkkstkcsnipsgsgaac
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iq7E (E:)
    asctftdaaaaikgkasctsiilngivvpagttldmtglksgttvtfqgkttfgykeweg
    plisfsgtniningasghsidcqgsrwwdskgsnggktkpkffyahslkssnikglnvln
    tpvqafsinsattlgvydviidnsagdsagghntdafdvgsstgvyisganvknqddcla
    insgtnitftggtcsgghglsigsvggrsdntvktvtisnskivnsdngvriktvsgatg
    svsgvtysgitlsniakygivieqdyengsptgtptngvpitgltlskitgsvassgtnv
    yilcasgacsnwkwsgvsvtggkkstkcsnipsgsgaac
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2iq7F (F:)
    asctftdaaaaikgkasctsiilngivvpagttldmtglksgttvtfqgkttfgykeweg
    plisfsgtniningasghsidcqgsrwwdskgsnggktkpkffyahslkssnikglnvln
    tpvqafsinsattlgvydviidnsagdsagghntdafdvgsstgvyisganvknqddcla
    insgtnitftggtcsgghglsigsvggrsdntvktvtisnskivnsdngvriktvsgatg
    svsgvtysgitlsniakygivieqdyengsptgtptngvpitgltlskitgsvassgtnv
    yilcasgacsnwkwsgvsvtggkkstkcsnipsgsgaac
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iq7F (F:)
    sctftdaaaaikgkasctsiilngivvpagttldmtglksgttvtfqgkttfgykewegp
    lisfsgtniningasghsidcqgsrwwdskgsnggktkpkffyahslkssnikglnvlnt
    pvqafsinsattlgvydviidnsagdsagghntdafdvgsstgvyisganvknqddclai
    nsgtnitftggtcsgghglsigsvggrsdntvktvtisnskivnsdngvriktvsgatgs
    vsgvtysgitlsniakygivieqdyengsptgtptngvpitgltlskitgsvassgtnvy
    ilcasgacsnwkwsgvsvtggkkstkcsnipsgsgaac
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iq7G (G:)
    asctftdaaaaikgkasctsiilngivvpagttldmtglksgttvtfqgkttfgykeweg
    plisfsgtniningasghsidcqgsrwwdskgsnggktkpkffyahslkssnikglnvln
    tpvqafsinsattlgvydviidnsagdsagghntdafdvgsstgvyisganvknqddcla
    insgtnitftggtcsgghglsigsvggrsdntvktvtisnskivnsdngvriktvsgatg
    svsgvtysgitlsniakygivieqdyengsptgtptngvpitgltlskitgsvassgtnv
    yilcasgacsnwkwsgvsvtggkkstkcsnipsgsgaac