PDB entry 2iq0

View 2iq0 on RCSB PDB site
Description: Crystal Structure of Aldose Reductase complexed with Hexanoic Acid
Class: oxidoreductase
Keywords: TIM-Barrel, ARI, aldo-keto reductase, OXIDOREDUCTASE
Deposited on 2006-10-12, released 2006-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1B1, ALDR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2iq0a_
  • Heterogens: NAP, 6NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iq0A (A:)
    asrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqe
    klreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgke
    ffpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpa
    vnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakh
    nkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcal
    lsctshkdypfheef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iq0A (A:)
    srlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqek
    lreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgkef
    fpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpav
    nqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakhn
    kttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcall
    sctshkdypfheef