PDB entry 2ipy

View 2ipy on RCSB PDB site
Description: crystal structure of iron regulatory protein 1 in complex with ferritin H IRE-RNA
Class: Lyase/RNA
Keywords: protein-RNA complex, Lyase-RNA COMPLEX
Deposited on 2006-10-12, released 2007-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-responsive element-binding protein 1
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01059 (0-887)
      • conflict (281)
      • engineered (435)
      • conflict (872)
    Domains in SCOPe 2.07: d2ipya1, d2ipya2
  • Chain 'B':
    Compound: Iron-responsive element-binding protein 1
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01059 (0-887)
      • conflict (281)
      • engineered (435)
      • conflict (872)
    Domains in SCOPe 2.07: d2ipyb1, d2ipyb2
  • Chain 'C':
    Compound: ferritin IRE RNA
  • Chain 'D':
    Compound: ferritin IRE RNA
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ipyA (A:)
    snpfaylaepldpaqpgkkffnlnkldysrygrlpfsirvlleaavrncdkflvkkedie
    nilnwnvtqhmnievpfkparvilqdftgvpsvvdfaamrdavkklggdpekinpicpvd
    lvidhsiqvdfnrradslqknqdlefernrerfeflkwgskafrnmriippgsgiihqvn
    leylarvvfdqdgyyypdslvgtdshttmidglgvlgwgvggieaeavmlgqpismvlpq
    vigyrlmgkphplvtstdivltitkhlrqvgvvgkfveffgpgvaqlsiadratianmcp
    eygatatffpvdevsikylvqtgrdeskvkqirkylqavgmfrdysdpsqdpdftqvvel
    dlktvvpccsgpkrpqdkvavsdmkkdfesclgakqgfkgfqvapdhhndhktfiyndse
    ftlshgsvviaaitsstntsnpsvmlgagllakkavdaglnvkpyvktslspgsgvvtyy
    lresgvmpylsqlgfdvvgygsmtsignsgplpepvveaitqgdlvavgvlsgnrnfegr
    vhpntranylaspplviayaiagtiridfekeplgtnakgqqvflrdiwptreeiqaver
    qyvipgmftevyqkietvnaswnalaapsdklylwnpkstyiksppffenltldlqppks
    ivdayvllnlgdsvttdhispagniarnspaaryltnrgltprefnsygsrrgndaimar
    gtfanirllnrflnkqapqtihlpsgetldvfdaaeryqqeghplivlagkeygsgssrd
    waakgpfllgikavlaesyerihrsnlvgmgvipleylpgenadslgltgrerytiiipe
    nltprmhvqvkldtgktfqavirfdtdveltyfhnggilnymirkmak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ipyA (A:)
    snpfaylaepldpaqpgkkffnlnkldysrygrlpfsirvlleaavrncdkflvkkedie
    nilnwnvtqhmnievpfkparvilqdftgvpsvvdfaamrdavkklggdpekinpicpvd
    lvidfernrerfeflkwgskafrnmriippgsgiihqvnleylarvvfdqdgyyypdslv
    gtdshttmidglgvlgwgvggieaeavmlgqpismvlpqvigyrlmgkphplvtstdivl
    titkhlrqvgvvgkfveffgpgvaqlsiadratianmcpeygatatffpvdevsikylvq
    tgrdeskvkqirkylqavgmfrdysdpsqdpdftqvveldlktvvpccsgpkrpqdkvav
    sdmkkdfesclgakqgfkgfqvapdhhndhktfiyndseftlshgsvviaaitsstntsn
    psvmlgagllakkavdaglnvkpyvktslspgsgvvtyylresgvmpylsqlgfdvplpe
    pvveaitqgdlvavgvlsgnrnfegrvhpntranylaspplviayaiagtiridfekepl
    gtnakgqqvflrdiwptreeiqaverqyvipgmftevyqkietvnassdklylwnpksty
    iksppffenltldlqppksivdayvllnlgdsvttdhispagniarnspaaryltnrglt
    prefnsygsrrgndaimargtfanirllnrflnkqapqtihlpsgetldvfdaaeryqqe
    ghplivlagkeygsgssrdwaakgpfllgikavlaesyerihrsnlvgmgvipleylpge
    nadslgltgrerytiiipenltprmhvqvkldtgktfqavirfdtdveltyfhnggilny
    mirkmak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ipyB (B:)
    snpfaylaepldpaqpgkkffnlnkldysrygrlpfsirvlleaavrncdkflvkkedie
    nilnwnvtqhmnievpfkparvilqdftgvpsvvdfaamrdavkklggdpekinpicpvd
    lvidhsiqvdfnrradslqknqdlefernrerfeflkwgskafrnmriippgsgiihqvn
    leylarvvfdqdgyyypdslvgtdshttmidglgvlgwgvggieaeavmlgqpismvlpq
    vigyrlmgkphplvtstdivltitkhlrqvgvvgkfveffgpgvaqlsiadratianmcp
    eygatatffpvdevsikylvqtgrdeskvkqirkylqavgmfrdysdpsqdpdftqvvel
    dlktvvpccsgpkrpqdkvavsdmkkdfesclgakqgfkgfqvapdhhndhktfiyndse
    ftlshgsvviaaitsstntsnpsvmlgagllakkavdaglnvkpyvktslspgsgvvtyy
    lresgvmpylsqlgfdvvgygsmtsignsgplpepvveaitqgdlvavgvlsgnrnfegr
    vhpntranylaspplviayaiagtiridfekeplgtnakgqqvflrdiwptreeiqaver
    qyvipgmftevyqkietvnaswnalaapsdklylwnpkstyiksppffenltldlqppks
    ivdayvllnlgdsvttdhispagniarnspaaryltnrgltprefnsygsrrgndaimar
    gtfanirllnrflnkqapqtihlpsgetldvfdaaeryqqeghplivlagkeygsgssrd
    waakgpfllgikavlaesyerihrsnlvgmgvipleylpgenadslgltgrerytiiipe
    nltprmhvqvkldtgktfqavirfdtdveltyfhnggilnymirkmak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ipyB (B:)
    snpfaylaepldpaqpgkkffnlnkldysrygrlpfsirvlleaavrncdkflvkkedie
    nilnwnvtqhmnievpfkparvilqdftgvpsvvdfaamrdavkklggdpekinpicpvd
    lvidfernrerfeflkwgskafrnmriippgsgiihqvnleylarvvfdqdgyyypdslv
    gtdshttmidglgvlgwgvggieaeavmlgqpismvlpqvigyrlmgkphplvtstdivl
    titkhlrqvgvvgkfveffgpgvaqlsiadratianmcpeygatatffpvdevsikylvq
    tgrdeskvkqirkylqavgmfrdysdpsqdpdftqvveldlktvvpccsgpkrpqdkvav
    sdmkkdfesclgakqgfkgfqvapdhhndhktfiyndseftlshgsvviaaitsstntsn
    psvmlgagllakkavdaglnvkpyvktslspgsgvvtyylresgvmpylsqlgfdvplpe
    pvveaitqgdlvavgvlsgnrnfegrvhpntranylaspplviayaiagtiridfekepl
    gtnakgqqvflrdiwptreeiqaverqyvipgmftevyqkietvnassdklylwnpksty
    iksppffenltldlqppksivdayvllnlgdsvttdhispagniarnspaaryltnrglt
    prefnsygsrrgndaimargtfanirllnrflnkqapqtihlpsgetldvfdaaeryqqe
    ghplivlagkeygsgssrdwaakgpfllgikavlaesyerihrsnlvgmgvipleylpge
    nadslgltgrerytiiipenltprmhvqvkldtgktfqavirfdtdveltyfhnggilny
    mirkmak
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.