PDB entry 2ipr

View 2ipr on RCSB PDB site
Description: Origin binding domain of the SV40 large T antigen (residues 131-259). P21 crystal form
Class: DNA binding protein
Keywords: DNA binding protein
Deposited on 2006-10-12, released 2006-12-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.179
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: large T antigen
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ipra_
  • Chain 'B':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: large T antigen
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2iprb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iprA (A:)
    gshmkvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisr
    hnsynhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsviee
    slpgglkehdfnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iprA (A:)
    vedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsyn
    hnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpgg
    lkehdfn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iprB (B:)
    gshmkvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisr
    hnsynhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsviee
    slpgglkehdfnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iprB (B:)
    dpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsynhn
    ilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpgglk
    ehdf