PDB entry 2ipq

View 2ipq on RCSB PDB site
Description: Crystal structure of C-terminal domain of Salmonella Enterica protein STY4665, PFAM DUF1528
Class: structural genomics, unknown function
Keywords: structural genomics, UNKNOWN FUNCTION, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2006-10-12, released 2006-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Hypothetical protein STY4665
  Species: SALMONELLA TYPHI [TaxId:601]
  Gene: STY4665, t4356
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8Z1C5
    • modified residue (78)
    • modified residue (114)
  Domains in SCOPe 2.08: d2ipqx1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence, based on SEQRES records: (download)
  

  >2ipqX (X:)
  slsstelgdlfwswlrdglregdipvntadacvhltcgfvfisvpgvfflflkshsrscs
  sglkesgrkeqvqaafekmrkhrvsdsrrfwqcclyeepggrgrykkltgylikmseiya
  ngnfpddslflkvin
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ipqX (X:)
  lsstelgdlfwswlrdglregdipvntadacvhltcgfvfisvpgvfflflkshgrkeqv
  qaafekmrkhrvsdsrrfwqcclyeepggrgrykkltgylikmseiyngnfpddslflkv
  i