PDB entry 2ipn

View 2ipn on RCSB PDB site
Description: Crystal structure of a disulfide mutant glucose binding protein
Class: sugar binding protein
Keywords: glucose binding protein, periplasmic binding protein, disulfide, SUGAR BINDING PROTEIN
Deposited on 2006-10-12, released 2007-03-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.153
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-galactose-binding periplasmic protein
    Species: Escherichia coli [TaxId:562]
    Gene: mglB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEE5
      • engineered (15)
      • engineered (213)
    Domains in SCOPe 2.05: d2ipna_
  • Heterogens: BGC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ipnA (A:)
    madtrigvtiykyddcfmsvvrkaieqdakaapdvqllmndsqndqskqndqidvllakg
    vkalainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgiiq
    gdliakhwaanqgwdlnkdgqiqfvllkgepghpdaearttyvikelndkgikteqlqld
    tamwdtaqakdkmdawlsgpnankievvianndcmamgavealkahnkssipvfgvdalp
    ealalvksgalagtvlndannqakatfdlaknladgkgaadgtnwkidnkvvrvpyvgvd
    kdnlaefskkgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ipnA (A:)
    dtrigvtiykyddcfmsvvrkaieqdakaapdvqllmndsqndqskqndqidvllakgvk
    alainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgiiqgd
    liakhwaanqgwdlnkdgqiqfvllkgepghpdaearttyvikelndkgikteqlqldta
    mwdtaqakdkmdawlsgpnankievvianndcmamgavealkahnkssipvfgvdalpea
    lalvksgalagtvlndannqakatfdlaknladgkgaadgtnwkidnkvvrvpyvgvdkd
    nlaef