PDB entry 2ipa

View 2ipa on RCSB PDB site
Description: solution structure of Trx-ArsC complex
Class: Electron transport/Oxidoreductase
Keywords: solution structure, complex, Electron transport/Oxidoreductase COMPLEX
Deposited on 2006-10-12, released 2007-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14949 (0-103)
      • engineered (31)
    Domains in SCOPe 2.08: d2ipaa_
  • Chain 'B':
    Compound: protein arsc
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45947 (0-138)
      • engineered (9)
      • engineered (14)
      • engineered (81)
    Domains in SCOPe 2.08: d2ipab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ipaA (A:)
    maivkatdqsfsaetsegvvladfwapwcgpskmiapvleeldqemgdklkivkidvden
    qetagkygvmsiptllvlkdgevvetsvgfkpkealqelvnkhl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ipaB (B:)
    menkiiyflstgnsarsqmaegwakqylgdewkvysagieahglnpnavkamkevgidis
    nqtsdiidsdilnnadlvvtlsgdaadkcpmtpphvkrehwgfddparaqgteeekwaff
    qrvrdeignrlkefaetgk