PDB entry 2iov

View 2iov on RCSB PDB site
Description: Bright-state structure of the reversibly switchable fluorescent protein Dronpa
Class: luminescent protein
Keywords: reversibly switchable fluorescent protein, green-fluorescent protein-like protein, LUMINESCENT PROTEIN
Deposited on 2006-10-11, released 2006-12-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (33-End)
      • chromophore (94)
    Domains in SCOPe 2.03: d2iova_
  • Chain 'B':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (94)
    Domains in SCOPe 2.03: d2iovb_
  • Chain 'C':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (33-End)
      • cloning artifact (30-32)
      • chromophore (94)
    Domains in SCOPe 2.03: d2iovc_
  • Chain 'D':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (33-End)
      • cloning artifact (31-32)
      • chromophore (94)
    Domains in SCOPe 2.03: d2iovd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iovA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstekly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iovA (A:)
    msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
    fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
    dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
    kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahsel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iovB (B:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstekly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iovB (B:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahselp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2iovC (C:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstekly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iovC (C:)
    kdpmsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydil
    ttvfcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiye
    irfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfktty
    kakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2iovD (D:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstekly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iovD (D:)
    dpmsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilt
    tvfcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyei
    rfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttyk
    akkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselp