PDB entry 2ios

View 2ios on RCSB PDB site
Description: Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form 3
Class: antitumor protein
Keywords: alpha-helical, ANTITUMOR PROTEIN
Deposited on 2006-10-10, released 2006-11-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.197
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed Cell Death 4, Pdcd4
    Species: Mus musculus [TaxId:10090]
    Gene: Pdcd4, MA-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61823
      • modified residue (30)
      • modified residue (127)
    Domains in SCOPe 2.05: d2iosa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2iosA (A:)
gqqpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesa
fkmildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagii
skqlrdlcpsrgrkrfvsegdggrlkpesy

    Sequence, based on observed residues (ATOM records): (download) 
    >2iosA (A:)
pvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafkm
ildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiiskq
lrdlcp