PDB entry 2ion

View 2ion on RCSB PDB site
Description: Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form2
Class: antitumor protein
Keywords: alpha-helical
Deposited on 2006-10-10, released 2006-11-14
The last revision prior to the SCOP 1.75 freeze date was dated 2007-01-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.162
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed Cell Death 4, Pdcd4
    Species: MUS MUSCULUS
    Gene: Pdcd4, MA-3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2iona1
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ionA (A:)
    gqqpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesa
    fkmildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagii
    skqlrdlcpsrsrgrkrfvsegdggrlkpesy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ionA (A:)
    qpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafk
    mildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiisk
    qlrdlcpsr