PDB entry 2iol

View 2iol on RCSB PDB site
Description: Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form 1
Class: antitumor protein
Keywords: alpha-helical
Deposited on 2006-10-10, released 2006-11-14
The last revision prior to the SCOP 1.75 freeze date was dated 2007-01-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.261
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed Cell Death 4, Pdcd4
    Species: MUS MUSCULUS
    Gene: Pdcd4, TIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61823
      • modified residue (13)
      • modified residue (50)
      • modified residue (62)
      • modified residue (81)
    Domains in SCOP 1.75: d2iola1
  • Chain 'B':
    Compound: Programmed Cell Death 4, Pdcd4
    Species: MUS MUSCULUS
    Gene: Pdcd4, TIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61823
      • modified residue (13)
      • modified residue (50)
      • modified residue (62)
      • modified residue (81)
    Domains in SCOP 1.75: d2iolb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iolA (A:)
    gqqpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesa
    fkmildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagii
    skqlrdlcpsrgrkrfvsegdggrlkpesy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iolA (A:)
    qpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafk
    mildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiisk
    qlrdlcp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iolB (B:)
    gqqpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesa
    fkmildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagii
    skqlrdlcpsrgrkrfvsegdggrlkpesy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iolB (B:)
    qpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafk
    mildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiisk
    qlrdlcp