PDB entry 2iok

View 2iok on RCSB PDB site
Description: Human estrogen receptor alpha ligand-binding domain in complex with compound 1D
Class: transcription
Keywords: nuclear receptor, transcription factor, er-alpha, antagonist
Deposited on 2006-10-10, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.215
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ioka_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2iokb_
  • Heterogens: IOK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iokA (A:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iokA (A:)
    lalsltadqmvsalldaeppilyseyeasmmglltnladrelvhminwakrvpgfvdltl
    hdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmllats
    srfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihlmak
    agltlqqqhqrlaqlllilshirhmsnkgmehlysmkplydllleml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iokB (B:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iokB (B:)
    lalsltadqmvsalldaeppilyseydptrasmmglltnladrelvhminwakrvpgfvd
    ltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmll
    atssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihl
    makagltlqqqhqrlaqlllilshirhmsnkgmehlysplydllleml