PDB entry 2iod

View 2iod on RCSB PDB site
Description: Binding of two substrate analogue molecules to dihydroflavonol-4-reductase alters the functional geometry of the catalytic site
Class: Oxidoreductase
Keywords: ROSSMANN FOLD, Oxidoreductase
Deposited on 2006-10-10, released 2007-09-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.193
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroflavonol 4-reductase
    Species: Vitis vinifera [TaxId:29760]
    Gene: DFR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ioda_
  • Chain 'B':
    Compound: dihydroflavonol 4-reductase
    Species: Vitis vinifera [TaxId:29760]
    Gene: DFR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2iodb_
  • Chain 'C':
    Compound: dihydroflavonol 4-reductase
    Species: Vitis vinifera [TaxId:29760]
    Gene: DFR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2iodc_
  • Chain 'D':
    Compound: dihydroflavonol 4-reductase
    Species: Vitis vinifera [TaxId:29760]
    Gene: DFR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2iodd_
  • Heterogens: NAP, MYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iodA (A:)
    mgsqsetvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltl
    wkadladegsfdeaikgctgvfhvatpmdfeskdpenevikptiegmlgimkscaaaktv
    rrlvftssagtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyake
    nnidfitiiptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiy
    lfenpkaegryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdl
    gfefkysledmftgavdtcrakgllppshekpvdgkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iodA (A:)
    etvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltlwkadl
    adegsfdeaikgctgvfhvatpmkdpenevikptiegmlgimkscaaaktvrrlvftssa
    gtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyakennidfitii
    ptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiylfenpkaeg
    ryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdlgfefkysle
    dmftgavdtcrakgllppsh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iodB (B:)
    mgsqsetvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltl
    wkadladegsfdeaikgctgvfhvatpmdfeskdpenevikptiegmlgimkscaaaktv
    rrlvftssagtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyake
    nnidfitiiptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiy
    lfenpkaegryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdl
    gfefkysledmftgavdtcrakgllppshekpvdgkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iodB (B:)
    mgsqsetvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltl
    wkadladegsfdeaikgctgvfhvatpmskdpenevikptiegmlgimkscaaaktvrrl
    vftssagtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyakenni
    dfitiiptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiylfe
    npkaegryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdlgfe
    fkysledmftgavdtcrakgllppsh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2iodC (C:)
    mgsqsetvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltl
    wkadladegsfdeaikgctgvfhvatpmdfeskdpenevikptiegmlgimkscaaaktv
    rrlvftssagtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyake
    nnidfitiiptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiy
    lfenpkaegryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdl
    gfefkysledmftgavdtcrakgllppshekpvdgkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iodC (C:)
    etvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltlwkadl
    adegsfdeaikgctgvfhvatpmdfeskdpenevikptiegmlgimkscaaaktvrrlvf
    tssagtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyakennidf
    itiiptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiylfenp
    kaegryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdlgfefk
    ysledmftgavdtcrakgllppshe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2iodD (D:)
    mgsqsetvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltl
    wkadladegsfdeaikgctgvfhvatpmdfeskdpenevikptiegmlgimkscaaaktv
    rrlvftssagtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyake
    nnidfitiiptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiy
    lfenpkaegryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdl
    gfefkysledmftgavdtcrakgllppshekpvdgkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iodD (D:)
    etvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltlwkadl
    adegsfdeaikgctgvfhvatpmskdpenevikptiegmlgimkscaaaktvrrlvftss
    agtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyakennidfiti
    iptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiylfenpkae
    gryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdlgfefkysl
    edmftgavdtcrakgllppsh