PDB entry 2ioc

View 2ioc on RCSB PDB site
Description: The crystal structure of TREX1 explains the 3' nucleotide specificity and reveals a polyproline II helix for protein partenring
Class: hydrolase
Keywords: proline helix, nucleotide complex, DnaQ family, HYDROLASE
Deposited on 2006-10-10, released 2007-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Three prime repair exonuclease 1
    Species: Mus musculus [TaxId:10090]
    Gene: Trex1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91XB0
      • modified residue (10)
      • modified residue (231)
    Domains in SCOPe 2.08: d2ioca1
  • Chain 'B':
    Compound: Three prime repair exonuclease 1
    Species: Mus musculus [TaxId:10090]
    Gene: Trex1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91XB0
      • modified residue (10)
      • modified residue (231)
    Domains in SCOPe 2.08: d2iocb_
  • Heterogens: MN, D5M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iocA (A:)
    mgsqtlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprp
    prvvdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcc
    lvahngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslg
    siytrlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmygtpattg
    tt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iocA (A:)
    tlphghmqtlifldleatglpssrpevtelcllavhrralenqghpppvprpprvvdkls
    lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
    ydfpllqtelarlstpspldgtfcvdsiaalkaleqasksyslgsiytrlywqaptdsht
    aegdvltllsicqwkpqallqwvdeharpfstvkpmyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iocB (B:)
    mgsqtlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprp
    prvvdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcc
    lvahngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslg
    siytrlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmygtpattg
    tt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iocB (B:)
    hghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkl
    slciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngd
    rydfpllqtelarlstpspldgtfcvdsiaalkaleqasrksyslgsiytrlywqaptds
    htaegdvltllsicqwkpqallqwvdeharpfstvkpmyg