PDB entry 2iob

View 2iob on RCSB PDB site
Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Apo protein
Class: ligase, hydrolase
Keywords: Bifunctional glutathionylspermidine synthetase/amidase, LIGASE, HYDROLASE
Deposited on 2006-10-10, released 2006-12-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional glutathionylspermidine synthetase/amidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ioba1, d2ioba2, d2ioba3
  • Chain 'B':
    Compound: Bifunctional glutathionylspermidine synthetase/amidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iobb1, d2iobb2, d2iobb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iobA (A:)
    mskgttsqdapfgtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcv
    efarrflflnygvvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliw
    dkggefkdtghvaiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtf
    ddttilgwmiqtedteyslpqpeiagellkisgarlenkgqfdgkwldekdplqnayvqa
    ngqvinqdpyhyytitesaeqelikatnelhlmylhatdkvlkddnllalfdipkilwpr
    lrlswqrrrhhmitgrmdfcmderglkvyeynadsaschteaglilerwaeqgykgngfn
    paeglinelagawkhsrarpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelg
    wdaagqlidgegrlvncvwktwawetafdqirevsdrefaavpirtghpqnevrlidvll
    rpevlvfeplwtvipgnkailpilwslfphhrylldtdftvndelvktgyavkpiagrcg
    snidlvshheevldktsgkfaeqkniyqqlwclpkvdgkyiqvctftvggnyggtclrgd
    eslvikkesdieplivvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iobA (A:)
    fgtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcvefarrflflny
    gvvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtgh
    vaiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiq
    tedteyslpqpeiagellkisgarlenkgqfdgkwldekdplqnayvqangqvinqdpyh
    yytitesaeqelikatnelhlmylhatdkvlkddnllalfdipkilwprlrlswqrrrhh
    mitgrmdfcmderglkvyeynadsaschteaglilerwaeqgykgngfnpaeglinelag
    awkhsrarpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwdaagqlidge
    grlvncvwktwawetafdqirevsdrefaavpirtghpqnevrlidvllrpevlvfeplw
    tvipgnkailpilwslfphhrylldtdftvnyavkpkniyqqlwclpkvdgkyiqvctft
    vggnyggtclrgdeslvikkesdieplivvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iobB (B:)
    mskgttsqdapfgtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcv
    efarrflflnygvvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliw
    dkggefkdtghvaiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtf
    ddttilgwmiqtedteyslpqpeiagellkisgarlenkgqfdgkwldekdplqnayvqa
    ngqvinqdpyhyytitesaeqelikatnelhlmylhatdkvlkddnllalfdipkilwpr
    lrlswqrrrhhmitgrmdfcmderglkvyeynadsaschteaglilerwaeqgykgngfn
    paeglinelagawkhsrarpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelg
    wdaagqlidgegrlvncvwktwawetafdqirevsdrefaavpirtghpqnevrlidvll
    rpevlvfeplwtvipgnkailpilwslfphhrylldtdftvndelvktgyavkpiagrcg
    snidlvshheevldktsgkfaeqkniyqqlwclpkvdgkyiqvctftvggnyggtclrgd
    eslvikkesdieplivvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iobB (B:)
    gtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcvefarrflflnyg
    vvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtghv
    aiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiqt
    edteyslpqpeiagellkisgarlenkgqfdgkwldekdplqnayvqangqvinqdpyhy
    ytitesaeqelikatnelhlmylhatdkvlkddnllalfdipkilwprlrlswqrrrhhm
    itgrmdfcmderglkvyeynadsaschteaglilerwaeqgykgngfnpaeglinelaga
    wkhsrarpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwdaagqlidgeg
    rlvncvwktwawetafdqirevsdrefaavpirtghpqnevrlidvllrpevlvfeplwt
    vipgnkailpilwslfphhrylldtdftvndelvktgyavkpiidlvkniyqqlwclpkv
    dgkyiqvctftvggnyggtclrgdeslvikkesdieplivvk