PDB entry 2io8

View 2io8 on RCSB PDB site
Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Incomplex with Mg2+ and ADP
Class: ligase, hydrolase
Keywords: Bifunctional glutathionylspermidine synthetase/amidase, LIGASE, HYDROLASE
Deposited on 2006-10-10, released 2006-12-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.173
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional glutathionylspermidine synthetase/amidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2io8a1, d2io8a2, d2io8a3
  • Chain 'B':
    Compound: Bifunctional glutathionylspermidine synthetase/amidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2io8b1, d2io8b2, d2io8b3
  • Heterogens: MG, CYS, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2io8A (A:)
    mskgttsqdapfgtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcv
    efarrflflnygvvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliw
    dkggefkdtghvaiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtf
    ddttilgwmiqtedteyslpqpeiagellkisgarlenkgqfdgkwldekdplqnayvqa
    ngqvinqdpyhyytitesaeqelikatnelhlmylhatdkvlkddnllalfdipkilwpr
    lrlswqrrrhhmitgrmdfcmderglkvyeynadsaschteaglilerwaeqgykgngfn
    paeglinelagawkhsrarpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelg
    wdaagqlidgegrlvncvwktwawetafdqirevsdrefaavpirtghpqnevrlidvll
    rpevlvfeplwtvipgnkailpilwslfphhrylldtdftvndelvktgyavkpiagrcg
    snidlvshheevldktsgkfaeqkniyqqlwclpkvdgkyiqvctftvggnyggtclrgd
    eslvikkesdieplivvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2io8A (A:)
    apfgtllgyapggvaiyssdysddavfrsyiddeymghkwqcvefarrflflnygvvftd
    vgmaweifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtghvaiitq
    lhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiqtedtey
    slpqpeiagellkisgarlenkgqfdgkwldekdplqnayvqangqvinqdpyhyytite
    saeqelikatnelhlmylhatdkvlkddnllalfdipkilwprlrlswqrrrhhmitgrm
    dfcmderglkvyeynadsaschteaglilerwaeqgykgngfnpaeglinelagawkhsr
    arpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwdaagqlidgegrlvnc
    vwktwawetafdqirevefaavpirtghpqnevrlidvllrpevlvfeplwtvipgnkai
    lpilwslfphhrylldtdftvndelvktgyavkpiagrcgsnidlvshheevldktsgkf
    aeqkniyqqlwclpkvdgkyiqvctftvggnyggtclrgdeslvikkesdieplivvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2io8B (B:)
    mskgttsqdapfgtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcv
    efarrflflnygvvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliw
    dkggefkdtghvaiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtf
    ddttilgwmiqtedteyslpqpeiagellkisgarlenkgqfdgkwldekdplqnayvqa
    ngqvinqdpyhyytitesaeqelikatnelhlmylhatdkvlkddnllalfdipkilwpr
    lrlswqrrrhhmitgrmdfcmderglkvyeynadsaschteaglilerwaeqgykgngfn
    paeglinelagawkhsrarpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelg
    wdaagqlidgegrlvncvwktwawetafdqirevsdrefaavpirtghpqnevrlidvll
    rpevlvfeplwtvipgnkailpilwslfphhrylldtdftvndelvktgyavkpiagrcg
    snidlvshheevldktsgkfaeqkniyqqlwclpkvdgkyiqvctftvggnyggtclrgd
    eslvikkesdieplivvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2io8B (B:)
    apfgtllgyapggvaiyssdavfrsyiddeymghkwqcvefarrflflnygvvftdvgma
    weifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtghvaiitqlhgn
    kvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiqtedteyslpq
    peiagellkisgarlenkgqfdgkwldekdplqnayvqangqvinqdpyhyytitesaeq
    elikatnelhlmylhatdkvlkddnllalfdipkilwprlrlswqrrrhhmitgrmdfcm
    derglkvyeynadsaschteaglilerwaeqgykgngfnpaeglinelagawkhsrarpf
    vhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwdaagqlidgegrlvncvwkt
    wawetafdqirevfaavpirtghpqnevrlidvllrpevlvfeplwtvipgnkailpilw
    slfphhrylldtdftvndelvktgyavkpiagrcgsnidlvshheevldktsgkfaeqkn
    iyqqlwclpkvdgkyiqvctftvggnyggtclrgdeslvikkesdieplivvk