PDB entry 2io5

View 2io5 on RCSB PDB site
Description: Crystal structure of the CIA- histone H3-H4 complex
Class: chaperone/structural protein
Keywords: histone, chaperone, chaperone-structural protein complex
Deposited on 2006-10-10, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.24
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ASF1A protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ASF1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2io5a1
  • Chain 'B':
    Compound: Histone H3.1
    Species: Xenopus laevis [TaxId:8355]
    Gene: Histone H3.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2io5b_
  • Chain 'C':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2io5c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2io5A (A:)
    gshmakvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvl
    dsvlvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnney
    tetelrenppvkpdfsklqrnilasnprvtrfhinwedntekledaessnpnlqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2io5A (A:)
    makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv
    lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet
    elrenppvkpdfsklqrnilasnprvtrfhinwe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2io5B (B:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2io5B (B:)
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvti
    mpkdiqlarrirgera
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2io5C (C:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2io5C (C:)
    dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
    mdvvyalkrqgrtlygf