PDB entry 2io2

View 2io2 on RCSB PDB site
Description: Crystal structure of human Senp2 in complex with RanGAP1-SUMO-1
Class: protein binding, hydrolase
Keywords: SUMO, Ubiquitin, Senp, Ulp, complex
Deposited on 2006-10-09, released 2006-11-21
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-02, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.268
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sentrin-specific protease 2
    Species: HOMO SAPIENS
    Gene: SENP2, KIAA1331
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (Start-231)
      • engineered (190)
  • Chain 'B':
    Compound: Small ubiquitin-related modifier 1
    Species: HOMO SAPIENS
    Gene: SUMO1, SMT3C, SMT3H3, UBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2io2b1
  • Chain 'C':
    Compound: ran gtpase-activating protein 1
    Species: HOMO SAPIENS
    Gene: RANGAP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46060 (Start-171)
      • engineered (157)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2io2B (B:)
    mgegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnh
    tpkelgmeeedvievyqeqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2io2B (B:)
    klkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkelgm
    eeedvievyqeqtgg
    

  • Chain 'C':
    No sequence available.