PDB entry 2inq

View 2inq on RCSB PDB site
Description: Neutron Crystal Structure of Escherichia coli Dihydrofolate Reductase Bound to the Anti-cancer drug, Methotrexate
Class: oxidoreductase
Keywords: Neutron Structure; Deuterium Exchange; Pseudo-Rossman Fold; Nucleotide Binding Domain; Chemotherapy, OXIDOREDUCTASE
Deposited on 2006-10-08, released 2007-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NEUT
Resolution: 2.2 Å
R-factor: 0.233
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: folA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • engineered (36)
    Domains in SCOPe 2.08: d2inqa_
  • Chain 'B':
    Compound: dihydrofolate reductase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: folA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • engineered (36)
    Domains in SCOPe 2.08: d2inqb_
  • Heterogens: MT1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2inqA (A:)
    misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
    ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
    gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2inqB (B:)
    misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
    ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
    gdthfpdyepddwesvfsefhdadaqnshsycfeilerr