PDB entry 2inb

View 2inb on RCSB PDB site
Description: Crystal structure of an XisH family protein (ZP_00107633.1) from Nostoc punctiforme PCC 73102 at 1.60 A resolution
Class: Structural Genomics/Unknown function
Keywords: ZP_00107633.1, hypothetical protein, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, Structural Genomics-Unknown function COMPLEX
Deposited on 2006-10-06, released 2006-10-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.16
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Nostoc punctiforme [TaxId:63737]
    Gene: ZP_00107633.1
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00107633 (Start-139)
      • modified residue (116)
      • modified residue (124)
    Domains in SCOPe 2.03: d2inba1
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2inbA (A:)
    gmsakdvfhqvvkialekdgwqitndpltisvggvnlsidlgaekliaaeregekiavev
    ksflerssaisefhtalgqfinyrgalrrrqpervlylavplttyktffqldfpkemiae
    nqvkmliydveqevifqwin
    

    Sequence, based on observed residues (ATOM records): (download)
    >2inbA (A:)
    dvfhqvvkialekdgwqitndpltisvggvnlkliaaeregekiavevksflerssaise
    fhtalgqfinyrgalrrrqpervlylavplttyktffqldfpkemiaenqvkmliydveq
    evifqwin