PDB entry 2inb

View 2inb on RCSB PDB site
Description: Crystal structure of an XisH family protein (ZP_00107633.1) from Nostoc punctiforme PCC 73102 at 1.60 A resolution
Class: Structural Genomics/Unknown function
Keywords: ZP_00107633.1, hypothetical protein, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, Structural Genomics-Unknown function COMPLEX
Deposited on 2006-10-06, released 2006-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein
  Species: Nostoc punctiforme [TaxId:63737]
  Gene: ZP_00107633.1
  Database cross-references and differences (RAF-indexed):
  • GB ZP_00107633 (Start-139)
  Domains in SCOPe 2.08: d2inba1
• Heterogens: CL, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2inbA (A:)
  gmsakdvfhqvvkialekdgwqitndpltisvggvnlsidlgaekliaaeregekiavev
  ksflerssaisefhtalgqfinyrgalrrrqpervlylavplttyktffqldfpkemiae
  nqvkmliydveqevifqwin
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2inbA (A:)
  dvfhqvvkialekdgwqitndpltisvggvnlkliaaeregekiavevksflerssaise
  fhtalgqfinyrgalrrrqpervlylavplttyktffqldfpkemiaenqvkmliydveq
  evifqwin