PDB entry 2in4

View 2in4 on RCSB PDB site
Description: Crystal Structure of Myoglobin with Charge Neutralized Heme, ZnDMb-dme
Class: oxygen storage/transport
Keywords: globin, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2006-10-05, released 2006-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.178
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2in4a_
  • Heterogens: SO4, HE5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2in4A (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg