PDB entry 2in1

View 2in1 on RCSB PDB site
Description: Crystal Structure of the Human Ubiquitin fold conjugating enzyme 1 (Ufc1), Northeast Structural Genomics Target HR41
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Ufm1-conjugating enzyme 1, UFC1, CGI-126, HSPC155, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-10-05, released 2006-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-10-21, with a file datestamp of 2008-10-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.266
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ufm1-conjugating enzyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RP11-297K8.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5VTX1
      • modified residue (108)
      • modified residue (137)
    Domains in SCOPe 2.06: d2in1a_
  • Chain 'B':
    Compound: Ufm1-conjugating enzyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RP11-297K8.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5VTX1
      • modified residue (108)
      • modified residue (137)
    Domains in SCOPe 2.06: d2in1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2in1A (A:)
    madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk
    egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh
    fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhkekcnqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2in1A (A:)
    deatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnkeg
    trwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdhfk
    plwarnvpkfglahlmalglgpwlaveipdliqkgviqhkek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2in1B (B:)
    madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk
    egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh
    fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhkekcnqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2in1B (B:)
    deatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnkeg
    trwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdhfk
    plwarnvpkfglahlmalglgpwlaveipdliqkgviqhkek