PDB entry 2imw

View 2imw on RCSB PDB site
Description: Mechanism of Template-Independent Nucleotide Incorporation Catalyzed by a Template-Dependent DNA Polymerase
Class: Transferase/DNA
Keywords: blunt end DNA Y-family polymerase DNA replication, Transferase-DNA COMPLEX
Deposited on 2006-10-05, released 2007-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: DNA polymerase IV
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: dbin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2imwp1, d2imwp2
  • Chain 'S':
    Compound: 5'-d(*gp*gp*gp*gp*gp*ap*ap*gp*gp*ap*tp*tp*c)-3'
  • Chain 'T':
    Compound: 5'-d(*tp*ap*gp*ap*ap*tp*cp*cp*tp*tp*cp*cp*cp*cp*c)-3'
  • Heterogens: CA, DDS, EDO, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2imwP (P:)
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfieaigldk

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.