PDB entry 2imt

View 2imt on RCSB PDB site
Description: The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site
Class: apoptosis
Keywords: dimer, APOPTOSIS
Deposited on 2006-10-04, released 2007-01-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.194
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator BAK
    Species: Homo sapiens [TaxId:9606]
    Gene: BAK1, BAK, BCL2L7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2imta_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2imtA (A:)
    epalpsaseeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvg
    rqlaiigddinrrydsefqtmlqhlqptaenayeyftkiatslfesginwgrvvallgfg
    yrlalhvyqhgltgflgqvtrfvvdfmlhhciarwiaqrggwvaalnlgng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2imtA (A:)
    saseeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrqlai
    igddinrrydsefqtmlqhlqptaenayeyftkiatslfesginwgrvvallgfgyrlal
    hvyqhgltgflgqvtrfvvdfmlhhciarwiaqrggwvaalnl