PDB entry 2ims

View 2ims on RCSB PDB site
Description: The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site
Class: apoptosis
Keywords: dimer, APOPTOSIS
Deposited on 2006-10-04, released 2006-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator BAK
    Species: Homo sapiens [TaxId:9606]
    Gene: BAK1, BAK, BCL2L7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16611
      • modified residue (44)
      • modified residue (55)
      • modified residue (80)
      • modified residue (146)
    Domains in SCOPe 2.08: d2imsa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2imsA (A:)
    epalpsaseeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvg
    rqlaiigddinrrydsefqtmlqhlqptaenayeyftkiatslfesginwgrvvallgfg
    yrlalhvyqhgltgflgqvtrfvvdfmlhhciarwiaqrggwvaalnlgng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2imsA (A:)
    lpsaseeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrql
    aiigddinrrydsefqtmlqhlqptaenayeyftkiatslfesginwgrvvallgfgyrl
    alhvyqhgltgflgqvtrfvvdfmlhhciarwiaqrggwvaal