PDB entry 2imn

View 2imn on RCSB PDB site
Description: Refined crystal structure of a recombinant immunoglobulin domain and a complementarity-determining region 1-grafted mutant
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1992-03-30, released 1993-07-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.149
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iga-kappa mcpc603 fv (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA72671 (0-112)
      • insertion (30)
      • conflict (30)
      • conflict (30)
    Domains in SCOPe 2.03: d2imna_
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2imnA (A:)
    divmtqspsslsvsagervtmsckssqsllykdgknflawyqqkpgqppklliygastre
    sgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtklelkr