PDB entry 2imn

View 2imn on RCSB PDB site
Description: Refined crystal structure of a recombinant immunoglobulin domain and a complementarity-determining region 1-grafted mutant
Deposited on 1992-03-30, released 1993-07-15
The last revision prior to the SCOP 1.65 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.97 Å
R-factor: 0.149
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d2imn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2imn_ (-)
    divmtqspsslsvsagervtmsckssqsllykdgknflawyqqkpgqppklliygastre
    sgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtklelkr