PDB entry 2imm

View 2imm on RCSB PDB site
Description: Refined crystal structure of a recombinant immunoglobulin domain and a complementarity-determining region 1-grafted mutant
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-03-01, released 1993-07-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.149
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: iga-kappa mcpc603 fv (light chain)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • GB AAA72671 (0-113)
  Domains in SCOPe 2.04: d2imma_
• Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2immA (A:)
  divmtqspsslsvsagervtmsckssqsllnsgnqknflawyqqkpgqppklliygastr
  esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtklelkr