PDB entry 2iml

View 2iml on RCSB PDB site
Description: Crystal structure of a hypothetical protein from Archaeoglobus fulgidus binding riboflavin 5'-phosphate
Class: flavoprotein
Keywords: FMN binding, PSI-2, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, FLAVOPROTEIN
Deposited on 2006-10-04, released 2006-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_1834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28442 (3-190)
      • cloning artifact (2)
      • modified residue (99)
      • modified residue (108)
      • modified residue (186)
      • cloning artifact (191-192)
    Domains in SCOPe 2.08: d2imla1, d2imla2, d2imla3
  • Chain 'B':
    Compound: hypothetical protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_1834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28442 (3-190)
      • cloning artifact (2)
      • modified residue (99)
      • modified residue (108)
      • modified residue (186)
      • cloning artifact (191)
    Domains in SCOPe 2.08: d2imlb2, d2imlb3, d2imlb4
  • Chain 'C':
    Compound: hypothetical protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_1834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28442 (3-190)
      • cloning artifact (2)
      • modified residue (99)
      • modified residue (108)
      • modified residue (186)
      • cloning artifact (191)
    Domains in SCOPe 2.08: d2imlc2, d2imlc3, d2imlc4
  • Chain 'D':
    Compound: hypothetical protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_1834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28442 (3-190)
      • cloning artifact (2)
      • modified residue (99)
      • modified residue (108)
      • modified residue (186)
      • cloning artifact (191-192)
      • expression tag (193-198)
    Domains in SCOPe 2.08: d2imld2, d2imld3, d2imld4
  • Heterogens: FMN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2imlA (A:)
    mslrladfgftdgineiiaitenedgswnaapigiivedsssdtakaklyrnrtranler
    sgvlfanvtddalvfavssfgnlnddwyaspnppiikgamawcrfeaemrsgvahlkltd
    geiiekrvrainrglsaviealvhatryvaiksderrkellerihyyreivqkcgserek
    rafeiimekigeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2imlA (A:)
    lrladfgftdgineiiaitenedgswnaapigiivedsssdtakaklyrnrtranlersg
    vlfanvtddalvfavssfgnlnddwyaspnppiikgamawcrfeaemrsgvahlkltdge
    iiekrvrainrglsaviealvhatryvaiksderrkellerihyyreivqkcgserekra
    feiimekigeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2imlB (B:)
    mslrladfgftdgineiiaitenedgswnaapigiivedsssdtakaklyrnrtranler
    sgvlfanvtddalvfavssfgnlnddwyaspnppiikgamawcrfeaemrsgvahlkltd
    geiiekrvrainrglsaviealvhatryvaiksderrkellerihyyreivqkcgserek
    rafeiimekigeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2imlB (B:)
    lrladfgftdgineiiaitenedgswnaapigiivedsssdtakaklyrnrtranlersg
    vlfanvtddalvfavssfgnlnddwyaspnppiikgamawcrfeaemrsgvahlkltdge
    iiekrvrainrglsaviealvhatryvaiksderrkellerihyyreivqkcgserekra
    feiimekige
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2imlC (C:)
    mslrladfgftdgineiiaitenedgswnaapigiivedsssdtakaklyrnrtranler
    sgvlfanvtddalvfavssfgnlnddwyaspnppiikgamawcrfeaemrsgvahlkltd
    geiiekrvrainrglsaviealvhatryvaiksderrkellerihyyreivqkcgserek
    rafeiimekigeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2imlC (C:)
    lrladfgftdgineiiaitenedgswnaapigiivedsssdtakaklyrnrtranlersg
    vlfanvtddalvfavssfgnlnddwyaspnppiikgamawcrfeaemrsgvahlkltdge
    iiekrvrainrglsaviealvhatryvaiksderrkellerihyyreivqkcgserekra
    feiimekige
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2imlD (D:)
    mslrladfgftdgineiiaitenedgswnaapigiivedsssdtakaklyrnrtranler
    sgvlfanvtddalvfavssfgnlnddwyaspnppiikgamawcrfeaemrsgvahlkltd
    geiiekrvrainrglsaviealvhatryvaiksderrkellerihyyreivqkcgserek
    rafeiimekigeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2imlD (D:)
    lrladfgftdgineiiaitenedgswnaapigiivedsssdtakaklyrnrtranlersg
    vlfanvtddalvfavssfgnlnddwyaspnppiikgamawcrfeaemrsgvahlkltdge
    iiekrvrainrglsaviealvhatryvaiksderrkellerihyyreivqkcgserekra
    feiimekigeghhhhhh