PDB entry 2im8

View 2im8 on RCSB PDB site
Description: X-Ray Crystal Structure of Protein yppE from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR213.
Class: structural genomics, unknown function
Keywords: X-Ray, SR213, yppE, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-10-03, released 2006-10-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.236
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yppE
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yppE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50833 (0-122)
      • modified residue (0)
      • modified residue (8)
      • modified residue (12)
    Domains in SCOPe 2.05: d2im8a_
  • Chain 'B':
    Compound: Hypothetical protein yppE
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yppE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50833 (0-End)
      • modified residue (0)
      • modified residue (8)
      • modified residue (12)
    Domains in SCOPe 2.05: d2im8b_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2im8A (A:)
    mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale
    likvrrpkyvhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiare
    dsrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2im8A (A:)
    mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale
    likvrrpkyvhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiare
    dsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2im8B (B:)
    mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale
    likvrrpkyvhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiare
    dsrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2im8B (B:)
    mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale
    likvrrphkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiar