PDB entry 2ilx

View 2ilx on RCSB PDB site
Description: Solution structure of catalytic domain of rat 2',3'-cyclic-nucleotide 3'-phosphodiesterase (CNP) protein
Class: hydrolase
Keywords: CNP, CNPase, nervous system, HYDROLASE
Deposited on 2006-10-03, released 2007-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2',3'-cyclic-nucleotide 3'-phosphodiesterase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13233 (4-218)
      • cloning artifact (0-3)
    Domains in SCOPe 2.07: d2ilxa2, d2ilxa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ilxA (A:)
    gshmflplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdepkekldlvs
    yfgkrppgvlhcttkfcdygkatgaeeyaqqdvvrrsygkafklsisalfvtpktagaqv
    vlneqelqlwpsdldkpssseslppgsrahvtlgcaadvqpvqtgldlleilqqvkggsq
    geevgelprgklyslgkgrwmlslakkmevkaiftgyyg