PDB entry 2iln

View 2iln on RCSB PDB site
Description: Crystal structure of the Bowman-Birk inhibitor from snail medic seeds in complex with bovine trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: Medicago scutellata, protease inhibitor, Bowman-Birk inhibitor, trypsin, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2006-10-03, released 2007-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.235
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ilna_
  • Chain 'B':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ilnb_
  • Chain 'I':
    Compound: bowman-birk type proteinase inhibitor
    Species: Medicago scutellata [TaxId:36901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ilni_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ilnA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ilnB (B:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ilnI (I:)
    tkstttaccdfcpctrsippqcqctdvrekchsacksclctrsfppqcrcyditdfcyps
    cs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ilnI (I:)
    ccdfcpctrsippqcqctdvrekchsacksclctrsfppqcrcyditdfcyps