PDB entry 2ilk

View 2ilk on RCSB PDB site
Description: crystal structure of human interleukin-10 at 1.6 angstroms resolution
Class: cytokine
Keywords: cytokine
Deposited on 1996-07-01, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.163
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ilka_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ilkA (A:)
    spgqgtqsenscthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgyl
    gcqalsemiqfyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkska
    veqvknafnklqekgiykamsefdifinyieaymtmkirn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ilkA (A:)
    tqsenscthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqal
    semiqfyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvk
    nafnklqekgiykamsefdifinyieaymtmkirn