PDB entry 2il4

View 2il4 on RCSB PDB site
Description: Crystal structure of At1g77540-Coenzyme A Complex
Class: transferase
Keywords: CoA, Coenzyme-A, COG2388 Family, acetyltransferase, At1g77540, STRUCTURAL GENOMICS FUNCTIONAL FOLLOW-UP STUDY, PROTEIN STRUCTURE INITIATIVE, PSI, CENTER FOR EUKARYOTIC STRUCTURAL GENOMICS, CESG, TRANSFERASE
Deposited on 2006-10-02, released 2006-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein At1g77540
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g77540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2il4a_
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2il4A (A:)
    mateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
    afehasshsisiipscsyvsdtflprnpswkplihsevfkssi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2il4A (A:)
    pkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeha
    sshsisiipscsyvsdtflprnpswkplih