PDB entry 2ik0

View 2ik0 on RCSB PDB site
Description: Yeast inorganic pyrophosphatase variant E48D with magnesium and phosphate
Class: hydrolase
Keywords: inorganic pyrophosphatase, mechanism, x-ray crystallography, structure-function, mutagenesis, hydrolase
Deposited on 2006-10-02, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.161
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IPP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00817 (0-End)
      • engineered (47)
    Domains in SCOPe 2.07: d2ik0a_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IPP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00817 (0-285)
      • engineered (47)
    Domains in SCOPe 2.07: d2ik0b_
  • Heterogens: MG, PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ik0A (A:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvvdiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffisgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ik0A (A:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvvdiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpvgdndpidvleigetia
    ytgqvkqvkalgimalldeetdwkviaidindplapklndiedvekyfpgllratnewfr
    iykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssskgidltnvtlpdtp
    tyskaasdaippaskadapidksidkwffis
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ik0B (B:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvvdiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffisgsv