PDB entry 2ijy

View 2ijy on RCSB PDB site
Description: NMR structure ensemble for the reduced DsbA disulphide oxidoreductase from Vibrio Cholerae
Class: oxidoreductase
Keywords: thioredoxin domain, helical domain insert, OXIDOREDUCTASE
Deposited on 2006-10-02, released 2007-07-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbA
    Species: Vibrio cholerae [TaxId:666]
    Gene: dsbA, tpcG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32557 (0-180)
      • variant (22)
      • cloning artifact (163)
    Domains in SCOPe 2.06: d2ijya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ijyA (A:)
    aqfkegehyqvlktpassspvvseffsfycphcntfepiiaqlkqqlpegakfqknhvsf
    mggnmgqamskayatmialevedkmvpvmfnrihtlrkppkdeqelrqifldegidaakf
    daayngfavdsmvrrfdkqfqdsgltgvpavvvnnrylvqgqsaksldeyfdlvnylltl
    k