PDB entry 2ijm

View 2ijm on RCSB PDB site
Description: Crystal Structure of Focal Adhesion Kinase Domain with 2 molecules in the Asymmetric Unit Complexed with ADP and ATP
Class: signaling protein,transferase
Keywords: kinase catalytic domain, SIGNALING PROTEIN,TRANSFERASE
Deposited on 2006-09-29, released 2007-08-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.211
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ijma_
  • Chain 'B':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ijmb_
  • Heterogens: ADP, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ijmA (A:)
    gastrdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekf
    lqealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyay
    qlstalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikw
    mapesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncp
    ptlyslmtkcwaydpsrrprftelkaqlstileeekaqqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ijmA (A:)
    dyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqeal
    tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlsta
    layleskrfvhrdiaarnvlvssndcvklgdfglslpikwmapesinfrrftsasdvwmf
    gvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrpr
    ftelkaqlstileeekaqqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ijmB (B:)
    gastrdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekf
    lqealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyay
    qlstalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikw
    mapesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncp
    ptlyslmtkcwaydpsrrprftelkaqlstileeekaqqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ijmB (B:)
    dyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqeal
    tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlsta
    layleskrfvhrdiaarnvlvssndcvklgdfglslpikwmapesinfrrftsasdvwmf
    gvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrpr
    ftelkaqlstileeekaqqee