PDB entry 2ijd

View 2ijd on RCSB PDB site
Description: Crystal Structure of the Poliovirus Precursor Protein 3CD
Class: hydrolase, transferase
Keywords: RNA polymerase, RNA-dependent RNA polymerase, poliovirus, picornavirus, protease, HYDROLASE, TRANSFERASE
Deposited on 2006-09-29, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.201
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Picornain 3C, RNA-directed RNA polymerase
    Species: Poliovirus [TaxId:12081]
    Gene: 3CD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03300 (0-643)
      • engineered (54)
      • engineered (57)
      • engineered (62)
      • engineered (146)
      • engineered (628)
      • engineered (637)
    Domains in SCOPe 2.07: d2ijd11, d2ijd12
  • Chain '2':
    Compound: Picornain 3C, RNA-directed RNA polymerase
    Species: Poliovirus [TaxId:12081]
    Gene: 3CD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03300 (0-643)
      • engineered (54)
      • engineered (57)
      • engineered (62)
      • engineered (146)
      • engineered (628)
      • engineered (637)
    Domains in SCOPe 2.07: d2ijd21, d2ijd22
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ijd1 (1:)
    gpgfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkevailaak
    aladqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpvgavt
    eqgylnlggrqtartlmynfptragqaggvitctgkvigmhvggngshgfaaalkrsyft
    qsqgeiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeea
    ifskyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsag
    ypyvamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlie
    asslndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgy
    daslspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifn
    sminnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpa
    dksatfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrsl
    cllawhngeeeynkflakirsvpigraldlpeystlydrwldsf
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ijd2 (2:)
    gpgfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkevailaak
    aladqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpvgavt
    eqgylnlggrqtartlmynfptragqaggvitctgkvigmhvggngshgfaaalkrsyft
    qsqgeiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeea
    ifskyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsag
    ypyvamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlie
    asslndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgy
    daslspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifn
    sminnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpa
    dksatfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrsl
    cllawhngeeeynkflakirsvpigraldlpeystlydrwldsf