PDB entry 2ij9

View 2ij9 on RCSB PDB site
Description: Crystal Structure of Uridylate Kinase from Archaeoglobus Fulgidus
Class: transferase
Keywords: KINASE, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, NYSGXRC, New York Structural GenomiX Research Consortium STRUCTURAL GENOMICS
Deposited on 2006-09-29, released 2006-10-17
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.284
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uridylate kinase
    Species: Archaeoglobus fulgidus
    Gene: pyrH, AF_2042
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28237 (0-218)
      • engineered (50)
    Domains in SCOP 1.73: d2ij9a1
  • Chain 'B':
    Compound: uridylate kinase
    Species: Archaeoglobus fulgidus
    Gene: pyrH, AF_2042
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28237 (0-218)
      • engineered (50)
    Domains in SCOP 1.73: d2ij9b1
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ij9A (A:)
    mkvvlslggsvlsnesekirefaktiesvaqqnqvfvvvgggklareyiksarelgaset
    fcdyigiaatrlnamllisaipsaakkvpvdfmeaeelsklyrvvvmggtfpghttdata
    allaefikadvfinatnvdgvysadpksdtsavkydrlspqqlveivsrssakagtnvvi
    dllaakiierskiktyvilgtpenimkavkgeavgtvia
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ij9A (A:)
    mkvvlslggsvlsnesekirefaktiesvaqqnqvfvvvgggklareyiksarelgaset
    fcdyigiaatrlnamllisaipsaakkvpvdfmeaeelsklyrvvvmggtfpghttdata
    allaefikadvfinatnvdgvysadpksdtsavkydrlspqqlveivsrgtnvvidllaa
    kiierskiktyvilgtpenimkavkgeavgtvia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ij9B (B:)
    mkvvlslggsvlsnesekirefaktiesvaqqnqvfvvvgggklareyiksarelgaset
    fcdyigiaatrlnamllisaipsaakkvpvdfmeaeelsklyrvvvmggtfpghttdata
    allaefikadvfinatnvdgvysadpksdtsavkydrlspqqlveivsrssakagtnvvi
    dllaakiierskiktyvilgtpenimkavkgeavgtvia
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ij9B (B:)
    mkvvlslggsvlsnesekirefaktiesvaqqnqvfvvvgggklareyiksarelgaset
    fcdyigiaatrlnamllisaipsaakkvpvdfmeaeelsklyrvvvmggtfpghttdata
    allaefikadvfinatnvdgvysadpksdtsavkydrlspqqlveivsrssgtnvvidll
    aakiierskiktyvilgtpenimkavkgeavgtvia