PDB entry 2ij2

View 2ij2 on RCSB PDB site
Description: Atomic structure of the heme domain of flavocytochrome P450-BM3
Class: oxidoreductase
Keywords: Cytochrome P450, P450BM3, monoxygenase, heme binding protein, atomic resolution
Deposited on 2006-09-29, released 2006-11-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.149
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 BM3
    Species: Bacillus megaterium
    Gene: CYP102A1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ij2a1
  • Chain 'B':
    Compound: Cytochrome P450 BM3
    Species: Bacillus megaterium
    Gene: CYP102A1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ij2b1
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ij2A (A:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkiplggipspsteqsakkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ij2A (A:)
    kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
    desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
    avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
    eamnklnpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpet
    geplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsy
    kqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdkt
    iwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfed
    htnyeldiketltlkpegfvvkakskkipl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ij2B (B:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkiplggipspsteqsakkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ij2B (B:)
    mpqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacde
    srfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdiav
    qlvqkwerlnaehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvraldeam
    nklqrydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgepldde
    niryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlk
    yvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgdvee
    frperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldi
    ketltlkpegfvvkakskkiplggipsp